GLRX3 anticorps (N-Term)

N° du produit ABIN632963

L’anticorps Lapin Polyclonal anti-GLRX3 a été validé pour WB. Il convient pour détecter GLRX3 dans des échantillons de Humain.

Aperçu rapide pour GLRX3 anticorps (N-Term) (ABIN632963)

Antigène: GLRX3 (Glutaredoxin 3 (GLRX3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GLRX3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GLRX3 anticorps

Épitope: N-Term

Specificité: GLRX3 antibody was raised against the N terminal of GLRX3

Purification: Affinity purified

Immunogène: GLRX3 antibody was raised using the N terminal of GLRX3 corresponding to a region with amino acids MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GLRX3 Blocking Peptide, (ABIN5613786), is also available for use as a blocking control in assays to test for specificity of this GLRX3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLRX3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GLRX3

Antigène: GLRX3 (Glutaredoxin 3 (GLRX3))

Autre désignation: GLRX3

Sujet: GLRX3 may play a role in regulating the function of the thioredoxin system.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis